Document Detail


A novel antimicrobial peptide from skin secretions of the earthworm, Pheretima guillelmi (Michaelsen).
MedLine Citation:
PMID:  21539875     Owner:  NLM     Status:  Publisher    
Abstract/OtherAbstract:
A novel lumbricin-like antimicrobial peptide named lumbricin-PG was isolated from skin secretions of the earthworm, Pheretima guillelmi (Michaelsen), using a procedure of one step Sephadex G-50 gel filtration and one step C(8) reverse-phase high-performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined as FSRYARMRDSRPWSDRKNNYSGPQFTYPPEKAPPEKLIKWNN EGSPIFEMPAEGGHIEP by Edman degradation combined with cDNA cloning and mass spectrometry analysis. The cDNA encoding lumbricin-PG was cloned by cDNA library screening. The predicted protein from the cDNA sequence was composed of 73 amino acid residues including a mature lumbricin-PG and predicted signal peptide. It showed similarity with lumbricin antimicrobial peptide from the earthworm, Lumbricus rubellus by BLAST search. Purified lumbricin-PG exerted potential antimicrobial activities against bacteria and fungi; it showed weak hemolysis activity against human and rabbit red cells.
Authors:
Wenliang Li; Sisi Li; Jian Zhong; Zhu Zhu; Jingze Liu; Wenhong Wang
Related Documents :
14871645 - Peptide-based immunotherapy of systemic lupus erythematosus.
10506655 - A new helicoid-type sequential oligopeptide carrier (soc(n)) for developing potent anti...
779765 - Correlation between the immunoadjuvant activities and pyrogenicities of synthetic n-ace...
1663745 - Comparison of the immune response against polio peptides covalently-surface-linked to a...
15616305 - Antibacterial activity and specificity of the six human {alpha}-defensins.
2670945 - Crystallographic quaternary structural analysis of amp nucleosidases from escherichia c...
Publication Detail:
Type:  JOURNAL ARTICLE     Date:  2011-4-22
Journal Detail:
Title:  Peptides     Volume:  -     ISSN:  1873-5169     ISO Abbreviation:  -     Publication Date:  2011 Apr 
Date Detail:
Created Date:  2011-5-4     Completed Date:  -     Revised Date:  -    
Medline Journal Info:
Nlm Unique ID:  8008690     Medline TA:  Peptides     Country:  -    
Other Details:
Languages:  ENG     Pagination:  -     Citation Subset:  -    
Copyright Information:
Copyright © 2011. Published by Elsevier Inc.
Affiliation:
Oncology Department, The First Affiliated Hospital of Kunming Medical College, Kunming 650032, Yunnan, China; Key Laboratory of Animal Physiology, Biochemistry and Molecular Biology of Hebei Province, College of Life Sciences, Hebei Normal University, Shijiazhuang, Hebei 050016, China.
Export Citation:
APA/MLA Format     Download EndNote     Download BibTex
MeSH Terms
Descriptor/Qualifier:

From MEDLINE®/PubMed®, a database of the U.S. National Library of Medicine


Previous Document:  Suppression of ANP secretion by somatostatin through somatostatin receptor type 2.
Next Document:  Identification of PSA peptide mimotopes using phage display peptide library.