| The intracellular portion of GITR enhances NGF-promoted neurite growth through an inverse modulation of Erk and NF-κB signalling. | |
| | |
| Jump to Full Text | |
MedLine Citation:
|
PMID: 23213379 Owner: NLM Status: PubMed-not-MEDLINE |
Abstract/OtherAbstract:
|
NF-κB transcription factors play a key role in regulating the growth of neural processes in the developing PNS. Although several secreted proteins have been shown to activate NF-κB to inhibit the growth of developing sympathetic neurons, it is unknown how the endogenous level of NF-κB activity present in these neurons is restricted to allow neurite growth to occur during their normal development. Here we show that activation of the glucocorticoid-induced tumour necrosis factor receptor (GITR) inhibits NF-κB activation while promoting the activation of Erk in developing sympathetic neurons. Conversely, inhibition of GITR results in an increase in NF-κB dependent gene transcription and a decrease in Erk activation leading to a reduction in neurite growth. These findings show that GITR signalling can regulate the extent of sympathetic neurite growth through an inverse modulation of Erk and NF-κB signalling, which provides an optimal environment for NGF-promoted growth. |
| | |
Authors:
|
Laura McKelvey; Humberto Gutierrez; Giuseppe Nocentini; Sean J Crampton; Alun M Davies; Carlo R Riccardi; Gerard W O'keeffe |
Related Documents
:
|
12426469 - Central nervous system-specific expression of g protein alpha subunits in the ascidian ... 11731259 - Expression of brain subtype creatine kinase in the zebrafish embryo. 19419239 - Visualisation and quantification of morphogen gradient formation in the zebrafish. 20695779 - Implication of hpets in gene regulatory networks responsible for specification of sea u... 9428419 - Increased cell death in rat blastocysts exposed to maternal diabetes in utero and to hi... 22965919 - The differences and correlations of bcr-abl transcripts between peripheral blood and bo... 11282169 - Expression of inducible nitric oxide synthase, interleukin-1 and caspase-1 in hiv-1 enc... 21751149 - Anti-inflammatory and anti-catabolic effects of tendoactive® on human tenocytes in vitro. 9834219 - Selective sp1 binding is critical for maximal activity of the human c-kit promoter. |
Publication Detail:
|
Type: Journal Article Date: 2012-08-20 |
Journal Detail:
|
Title: Biology open Volume: 1 ISSN: 2046-6390 ISO Abbreviation: Biol Open Publication Date: 2012 Oct |
Date Detail:
|
Created Date: 2012-12-05 Completed Date: 2012-12-06 Revised Date: 2012-12-11 |
Medline Journal Info:
|
Nlm Unique ID: 101578018 Medline TA: Biol Open Country: England |
Other Details:
|
Languages: eng Pagination: 1016-23 Citation Subset: - |
Affiliation:
|
Department of Anatomy and Neuroscience, Biosciences Institute, University College Cork , Cork , Ireland. |
Export Citation:
|
APA/MLA Format Download EndNote Download BibTex |
| MeSH Terms | |
Descriptor/Qualifier:
|
|
| Full Text | |
|
Journal Information Journal ID (nlm-ta): Biol Open Journal ID (iso-abbrev): Biol Open Journal ID (hwp): biolopen Journal ID (publisher-id): bio ISSN: 2046-6390 Publisher: The Company of Biologists, Bidder Building, 140 Cowley Road, Cambridge, CB4 0DL, UK |
Article Information Download PDF ![]() © 2012. Published by The Company of Biologists Ltd open-access: Received Day: 21 Month: 2 Year: 2012 Accepted Day: 5 Month: 7 Year: 2012 collection publication date: Day: 15 Month: 10 Year: 2012 Electronic publication date: Day: 20 Month: 8 Year: 2012 Volume: 1 Issue: 10 First Page: 1016 Last Page: 1023 PubMed Id: 23213379 ID: 3507174 Publisher Id: BIO20121024 DOI: 10.1242/bio.20121024 |
| The intracellular portion of GITR enhances NGF-promoted neurite growth through an inverse modulation of Erk and NF-κB signalling | |
| Laura McKelvey1* | |
| Humberto Gutierrez2* | |
| Giuseppe Nocentini3 | |
| Sean J. Crampton1 | |
| Alun M. Davies4 | |
| Carlo R. Riccardi3 | |
| Gerard W. O’keeffe1‡ | |
|
1Department of Anatomy and Neuroscience, Biosciences Institute, University College Cork, Cork, Ireland |
|
|
2Instituto de Fisiología Celular, Universidad Nacional Autónoma de México (UNAM), Ciudad Universitaria, CP 04510, México D.F. México |
|
|
3Department of Clinical and Experimental Medicine, Section of Pharmacology, University of Perugia, Via del Giochetto, 06100 Perugia, Italy |
|
|
4Cardiff School of Biosciences, Cardiff University, Cardiff CF10 3AX, Wales |
|
| *These authors contributed equally to this work ‡Author for correspondence (g.okeeffe@ucc.ie) |
|
The growth of axons to and within their targets during development of the peripheral nervous system (PNS) is controlled by a variety of extrinsic and intrinsic signals (Glebova and Ginty, 2005; Honma et al., 2002; Markus et al., 2002; Thompson et al., 2004; O'Keeffe et al., 2008; Vizard et al., 2008; Bodmer et al., 2009; Armstrong et al., 2011). One of the key regulators of axonal growth in the PNS is nerve growth factor (NGF) (Levi-Montalcini, 1987). In the PNS, post-ganglionic sympathetic neurons require a constant supply of target-derived nerve growth factor (NGF), in order to survive, and maintain their connections (Glebova and Ginty, 2004). Within the target regions innervated by these neurons, NGF acts locally on axon terminals to promote their growth, branching and refinement of connections (Campenot, 1994; Edwards et al., 1989).
Recently the nuclear factor-kappaB (NF-κB) transcription factor has been shown to be a key regulator of axonal growth in developing sympathetic and sensory neurons (Gallagher et al., 2007; Gutierrez et al., 2005; Gutierrez et al., 2008; Gavaldà et al., 2009; Gutierrez and Davies, 2011; Nolan et al., 2011). There are basal levels of NF-κB activity found in neonatal superior sympathetic ganglion (SCG) neurons (Gutierrez et al., 2008; Nolan et al., 2011), and any increase in its basal level of activity is known to inhibit axonal growth in these neurons (Gutierrez et al., 2008). As there are factors present in the SCG and its targets that activate NF-κB (Nolan et al., 2011), thus inhibiting axonal growth, there must be other factors, produced in these targets regions or indeed by the neurons themselves, that act to dampen NF-κB activation in order to provide a permissive niche for the facilitation of NGF-promoted axonal growth.
Recently a novel autocrine signalling loop involving the glucocorticoid-induced tumour necrosis factor receptor (GITR) and its ligand GITRL, has been shown to be crucial for NGF-promoted axonal growth and target innervation by post-ganglionic sympathetic neurons of the SCG (O'Keeffe et al., 2008). GITR, like the p75 neurotrophin receptor, is a member of the TNF receptor superfamily. GITRL and GITR are widely expressed in many tissues and a large body of evidence has shown that they are important for regulating innate and acquired immune responses (Krausz et al., 2007). In developing sympathetic neurons, GITR is required for the full growth promoting effects of NGF through a mechanism that facilitates NGF-promoted Erk activation (O'Keeffe et al., 2008). Interestingly, GITR has also been shown to promote or inhibit NF-κB signalling depending on the cellular context (Esparza and Arch, 2004; Esparza et al., 2006; Grohmann et al., 2007; Bae et al., 2008; Zhou et al., 2008). Because of its ability to regulate NF-κB activation and its positive role in NGF-promoted axonal growth, we hypothesised that GITR could conceivably functions to dampen NF-κB activity in neonatal neurons, thus preventing NF-κB from actively inhibiting axonal growth. In this study we establish the importance of GITR signalling as a novel simultaneous regulator of both Erk and NF-κB signalling in sympathetic neurons and propose a mechanism whereby GITR provides an optimal environment for NGF-promoted growth during the stage of active target innervation.
Dissociated cultures of SCG neurons from newborn C57/CD1 mice were grown in polyornithine/laminin coated 35 mm tissue culture dishes in defined medium and were transfected using Invitrogen Neon microporation kit prior to plating (Gutierrez et al., 2008). In all experiments, the neurons were transfected with a GFP expression plasmid to identify transfected neurons and visualise their neurite arbors for analysis. SCG neurons were grown in medium containing 10 ng/ml NGF (R&D systems).
To estimate the relative level of NF-κB activation, neurons were transfected with a plasmid expressing GFP under the control of an NF-κB promoter. Neurons were imaged with a Zeiss Axioplan confocal microscope and mean soma fluorescence intensity was obtained using LSM510 software (Gutierrez et al., 2005).
GFP-labelled neurons were visualised and digitally acquired using an Axioplan Zeiss laser scanning confocal microscope. Total neurite length and Sholl analysis was carried out as previously described (Gutierrez and Davies, 2007; O'Keeffe et al., 2008).
Cultures were fixed in 4% paraformaldehyde and washed with phosphate-buffered-saline (PBS), then blocked with 5% BSA in PBS. The cells were incubated overnight with primary antibody in 1% BSA at 4°C. The primary antibodies were: β-III tubulin (Promega, 1:1000); GITRL (R&D systems, 1:100); pSer536-p65 (Cell signalling 1:50) and phospho ERK 1/2 (Cell signalling 1:100). After washing, the cells were incubated with the appropriate secondary antibody (Alexa-Fluor, Invitrogen, 1:500) and were counterstained with DAPI (Chemicon).
GITR full length was cloned in the pSecTag plasmid (Invitrogen) previously modified by removing the two original NsiI sites. All GITR transmembrane-cytoplasmic mutants have been firstly cloned by inserting PCR mutant products into the pCR3.1 plasmid (Invitrogen), then cut by NotI and NsiI restriction enzymes and subcloned into NotI and NsiI sites of GITR full length. The NotI site was present in the cloning site of the plasmids, the NsiI site was present in the GITR sequence (534–539 base pairs in the NCBI NM_009400.2 sequence, corresponding to MA amino acids present in the GITR transmembrane domain). The cytoplasmic amino acid sequence of GITR is IWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP and that of GITRk, GITRz and GITRw was shorther, lacking part of the amino acids at the –COOH end. In particular, the cytoplasmic amino acid sequence of GITRk was IWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERG, that of GITRz was IWQLRRQHMCPRETQPFAEVQLS and that of GITRw was IW.
In the immune system, GITRL-GITR signalling has been shown to function through a transduction cascade downstream of GITR (Esparza and Arch, 2004; Esparza et al., 2006; Zhou et al., 2008). However, GITRL is also a transmembrane protein, and reverse signalling, through GITRL has recently been demonstrated upon its binding to GITR (Grohmann et al., 2007; Bae et al., 2008). In order to further explore how GITRL-GITR signalling regulates neurite growth in neurons, we created plasmids that express specific mutants of GITR that lack specific regions of the intracellular tail, GITRδW, GITRδK and GITRδZ, as well as a GITRLδW mutant that lacks the intracellular tail of GITRL and examined their effects on neurite growth.
Firstly, using immunocytochemistry, we confirmed GITRL and GITR expression in cultured neonatal mouse SCG neurons, which is a period of development in vivo when these neurons are undergoing extensive growth and branching within their peripheral targets. GITRL (Fig. 1A) and GITR (not shown) were specifically expressed on neurons, as identified by β-III tubulin staining (Fig. 1A, blue arrow), and were not found on non-neuronal cells (Fig. 1A, white arrow). We next transfected P1 SCG neurons with expression vectors for GITRL or antisense GITR., Confirming a previous report (O'Keeffe et al., 2008), neurons overexpressing GITRL displayed a significant increase in neurite length compared to their control counterparts (Fig. 1C), whereas those expressing antisense GITR had a significant decrease in neurite length (Fig. 1C).
To identify the specific region of GITR required for its growth promoting effects, we transfected P1 mouse SCG neurons with expression plasmids for GITRδW, GITRδK, GITRδZ (Fig. 2A) and the GITRLδW protein and examined their effects on neurite growth. To measure growth and elaboration of neurite arbours we used Sholl analysis, which provides a graphic illustration of neurite length and branching with distance from the cell body (Sholl, 1953; Gutierrez and Davies, 2007). Neurons overexpressing GITRδW displayed a significant decrease in their Sholl profile (Fig. 2B,C) compared to their control counterparts. This reduction in growth was comparable to those neurons overexpressing anti-sense GITR (data not shown).
In marked contrast, neurons expressing the GITRδK (Fig. 2A–C) and GITRδZ (Fig. 2A–C) had no significant decrease in the Sholl profile compared to their control counterparts demonstrating the specific requirement of the immediate juxtamembrane segment of the receptor in the growth promoting effects of GITR. On the other hand, neurons overexpressing GITRLδW displayed a significant increase in neurite growth compared to their control counterparts (data not shown), demonstrating that binding of the extracellular tail of GITRL to GITR is sufficient to trigger a growth promoting effect. Collectively, these data show that GITRL-GITR signalling promotes process growth in neonatal SCG neurons through the GITR intracellular domain and identify the growth-promoting region responsible for mediating this effect (Fig. 2D).
Having identified the growth promoting domain of GITR, we next asked if this region could influence NGF-induced Erk activation which is required for the growth promoting effects of NGF in developing SCG neurons (O'Keeffe et al., 2008). To this end, P1 mouse SCG neurons were transfected with expression plasmids for GITRδW, GITRδK and GITRδZ and grown for 24 h in medium containing NGF before immunocytochemically staining them for phospho-Erk. Densitometric analysis was conducted to assess relative levels of phospho-Erk on individual neurons. Transfected cells were identified by co-transfecting a GFP-expressing plasmid (Fig. 3A). Importantly, neurons transfected with a control empty plasmid displayed the same level of phospho-Erk as non-transfected neurons, indicating that the transfection procedure did not alter the relative activation of this pathway (Fig. 3B). Interestingly, neurons expressing GITRδW had significantly lower levels of phospho-Erk when compared to non-transfected and control-transfected neurons (P<0.001) (Fig. 3A,B). There was no reduction, however, in the level of phospho-Erk staining in cells transfected with GITRδK and GITRδZ compared with non-transfected and control-transfected neurons (Fig. 3C,D). These results show that the GITR-mediated enhancement of NGF-induced Erk activation requires the intracellular growth promoting domain of GITR.
Outside the nervous system, GITR has been shown to promote or inhibit NF-κB signalling depending on the cellular context (Esparza and Arch, 2004; Esparza et al., 2006; Grohmann et al., 2007; Bae et al., 2008; Zhou et al., 2008). As NF-κB, on the other hand, inhibits neurite growth in developing SCG neurons, we asked whether GITR regulated NF-κB in these neurons. Given their opposing effects, we hypothesised that GITRL-GITR signalling may function to maintain low levels of NF-κB activity in sympathetic neurons (Gutierrez et al., 2008; Nolan et al., 2011). To assess the regulatory influence of GITRL-GITR signalling on NF-κB signalling in developing sympathetic neurons, we transfected P1 SCG neurons with either a control plasmid or a GITRL plasmid and co-transfected these cells with a reporter plasmid expressing GFP under the control of an NF-κB promoter and compared the fluorescence intensity in experimental and control neurons (Gutierrez et al., 2005; Gallagher et al., 2007; Gutierrez et al., 2008). As a positive control, we also transfected P1 SCG neurons with a plasmid that expresses a mutated dominant negative IκBα protein with serine-to-alanine substitutions at residues 32 and 36 that is known to inhibit NF-κB dependent transcriptional activity (Roff et al., 1996).
Interestingly, neurons transfected with GITRL displayed a marked decrease in NF-κB reporter signal to at least the same extent as neurons transfected with the S32A/S36A IκBα mutant when compared with control-transfected neurons (Fig. 4A,B). These results show that GITRL-GITR signalling inhibits NF-κB signalling in neonatal SCG neurons. In order to test if basal levels of GITRL-GITR signalling are required to restrict NF-κB activity in neonatal SCG neurons, we used three complementary approaches to inhibit GITRL-GITR signalling and assess the effect on NF-κB transcriptional activity. Firstly, we overexpressed the GITRδW mutant receptor along with the NF-κB reporter plasmid and examined its effects on NF-κB transcriptional activity compared to that of an empty control plasmid. The overexpression of GITRδW in neonatal SCG neurons resulted in a significant increase in NF-κB-dependent transcriptional activity (Fig. 4C). We next transfected P1 SCG neurons with the NF-κB reporter plasmid and determined its response to a GITR-IgG function blocking antibody, which has been previously shown to block GITR signalling and inhibit axonal growth (O'Keeffe et al., 2008). Treatment with GITR-IgG resulted in a significant increase in the NF-κB reporter signal in these neurons (Fig. 4D). Finally, in neurons transfected with either the GITRδW mutant or an empty control plasmid, we examined the nuclear translocation of pS536-p65, which is the phosphorylated form of the NF-κB subunit known to actively inhibit neurite growth in these neurons (Gutierrez et al., 2008). As shown in Fig. 4E,F, there was a significant increase in nuclear pSer536-p65 NF-κB in neurons expressing GITRδW compared with non-transfected and control-transfected neurons (P<0.001). Collectively, these data show that endogenous GITR signalling down regulates NF-κB-dependent transcriptional activity in P1 SCG neurons.
To determine if preventing enhanced NF-κB activation could reverse the decrease in neurite growth following GITR inhibition, we co-transfected neonatal SCG neurons with either the GITRδW or antisense GITR plasmids together with a plasmid expressing a dominant negative K44A IKKβ protein or a control plasmid. We chose to use the IKKβ dominant negative (DN) plasmid as we have previously shown that IKKβ, not IKKα activity is responsible for mediating the growth inhibitory effects of NF-κB in neonatal SCG neurons (Gutierrez et al., 2008). Neurons transfected with either an antisense GITR (Fig. 5A,B) or GITRδW (Fig. 5A,C) displayed significant reductions in neurite length. However, neurons co-transfected with either antisense GITR or GITRδW plasmids together with a K44A IKKβ expression plasmid displayed growth profiles identical to those of neurons transfected with an empty control plasmid. These data show that IKKβ-dependent NF-κB activity is responsible for the inhibition of neurite growth resulting from endogenous GITR inhibition.
We have previously shown that GITRL/GITR signalling facilitates NGF mediated Erk activation, which is required for NGF-promoted neurite growth in developing SCG neurons (O'Keeffe et al., 2008). Given the observed inhibitory influence of GITRL/GITR on NF-κB signalling, we examined the potential link between NF-κB and Erk signalling in the promotion of neurite growth upon GITR stimulation in developing SCG neurons. Firstly, we transfected P1 SCG neurons with expression plasmids for the NF-κB p65 subunit and/or GITRL with the NF-κB reporter plasmid and examined their effects on neurite growth and NF-κB transcriptional activity. In agreement with our previous findings, p65 and GITRL-expressing neurons showed a significant increase and decrease in neurite growth respectively than control neurons (O'Keeffe et al., 2008; Gutierrez et al., 2005) (Fig. 6A,B). Interestingly, neurons co-transfected with both GITRL and p65 were not significantly different in size when compared to controls, but were significantly larger than neurons transfected with p65 alone and significantly smaller than those expressing GITRL alone (Fig. 6A,B). When we analysed NF-κB transcriptional activity in these neurons, the overexpression of either p65 or GITRL in neonatal SCG neurons resulted in a significant increase and decrease respectively in NF-κB-dependent transcriptional activity (Fig. 6C). Interestingly, cells expressing both p65 and GITRL displayed the same degree of increase in NF-κB-dependent transcriptional activity as those expressing p65 alone. The latter result contrasts with the fact that, in terms of neurite growth, p65/GITRL expressing neurons are significantly larger than those expressing p65 alone, suggesting that this is due to GITRL engaging a second signal that opposes NF-κB and leads to NGF-promoted neurite growth.
To determine if this is the case, we assessed the levels of phospho-Erk in neurons transfected with expression plasmids for p65 and/or GITRL. Surprisingly neurons expressing p65 had significantly lower levels of phospho-Erk than their control counterparts, whereas those expressing GITRL displayed significantly higher levels of active Erk when compared to control transfected neurons (Fig. 7A). However, neurons co-expressing both p65 and GITRL had the same degree of Erk activation as control transfected neurons (Fig. 7A). When we related this to the effects on neurite growth (Fig. 7B), it became clear that the extent of NGF-promoted neurite growth was related to the level of phospho-Erk in these neurons, which can in turn be modulated by altering NF-κB signalling (Fig. 7C). Taken together, these results show that GITRL-GITR signalling exerts an inverse modulation of NF-κB and Erk signalling which is essential for NGF-promoted neurite growth.
NGF, the founding member of the neurotrophins family of proteins, was discovered over half a century ago by its ability to promote neuronal survival and axonal growth, and is the paradigmatic target-derived neurotrophic factor on which the neurotrophic hypothesis is based. It recent years, a number of studies have identified new molecules involved in the NGF-promoted axonal growth of sympathetic neurons, including GITR (O'Keeffe et al., 2008), CaSR (Vizard et al., 2008), Wnt5a (Bodmer et al., 2009), Frizzled3 (Armstrong et al., 2011) and others. Our study highlights a previously unknown autocrine regulatory pathway in which autocrine expression of GITR in neonatal SCG neurons, is responsible for the simultaneous but inverse regulation of Erk and NF-κB activity in these neurons, bringing about the balance in their activation and inhibition required for optimal for neurite growth. We show that activating or inhibiting GITRL-GITR in neonatal SCG neurons promotes and inhibits axonal growth respectively. We demonstrate that activation of GITR signalling inhibits NF-κB-dependent transcriptional activity while facilitating Erk activation in these neurons. Conversely, inhibition of GITR signalling, results in increased NF-κB activity and a decrease in Erk activation leading to a decrease in neurite growth in these neurons.
The precise mechanism of how GITR inhibits NF-κB signalling in sympathetic neurons is unclear. In many cases, activation of a member of the TNFSF, family of receptors, results in recruitment of the receptor associated proteins TRADD and tumour necrosis factor receptor-associated factor (TRAF) 2, 5 or 6 (Hauer et al., 2005). This results in the phosphorylation of the IKK complex which, in turn, phosphorylates IκBα, targeting it for degradation, allowing phosphorylated NF-κB to translocate to the nucleus. Usually TRAF2 recruitment activates NF-κB; however, in primary lymphocytes, GITR has been shown to engage TRAF2 in a novel fashion as an inhibitor of NF-κB activation (Esparza and Arch, 2004). TRAF3 also serves as a negative regulator of the NF-κB pathway for many members of the TNF superfamily, including GITR (Hauer et al., 2005). However, a preliminary in silico analysis (unpublished observations) predicts that the TRAF binding region of GITR is located outside the growth promoting domain. The GITRδK and GITRδZ deletions disrupt this predicted TRAF binding region, but as neurons expressing these mutated forms of GITR grow normally, it would seem that GITR signalling in neurons is possibly TRAF independent. Further work will be required to ascertain the precise mechanism for GITR-mediated inhibition of NF-κB.
Although previous studies in the immune system have described the involvement of GITR in activating NF-κB and Erk (Esparza et al., 2006), to our knowledge this is the first report of an inverse regulation of these signalling pathways mediated by GITR. Interestingly, Erk and NF-κB signalling have been shown to be regulated by tumour progression locus 2 (TPL2), which is a serine threonine kinase that under homeostatic conditions is stoichiometrically associated with the NF-κB component p105, the precursor of p50 (Waterfield et al., 2003; Beinke et al., 2004). Upon stimulation of the IKK complex, p105 is phosphorylated and degraded resulting in the release of TPL2. TPL2 can then phosphorylate MEK1/2 which in turn activates ERK1/2 (Das et al., 2005). In the NF-κB pathway, TPL2 functions downstream of IKK-β, and it does not regulate the degradation of IκB-α or the subsequent nuclear translocation of the p50 or p65 subunits but is instead involved in the phosphorylation of p65 (Waterfield et al., 2003). On the other hand, Tpl2 has been shown to be recruited by the CD40 receptor (a member of the TNF superfamily) upon its stimulation in a TRAF6-dependent manner (Eliopoulos et al., 2003). While it remains to be assertained, Tpl2 could therefore provide a potential link between GITR and the simultaneous modulation of both Erk and NF-κB signalling.
The key role of NF-κB transcription factors in the negative regulation of axonal growth of developing sympathetic neurons has been previously described (Gutierrez et al., 2008). Experimental enhancement of NF-κB in neonatal sympathetic neurons, either by inflammatory cytokines (Gutierrez et al., 2008; Nolan et al., 2011) or by overexpressing its components (Gutierrez et al., 2008), leads to a strong inhibition of axonal growth. Our present findings show that NF-κB signalling results in a reduction in the level of NGF-induced Erk activation in those neurons. This suggests a potential mechanism whereby when neonatal sympathetic neurons innervate their targets, NF-κB activity is maintained at a relatively low level by GITR-GITRL signalling, while there is a high degree of activity of NGF-induced Erk-MAP kinase signalling as well as other downstream NGF-effectors (O'Keeffe et al., 2008; Bodmer et al., 2009), allowing an adequate rate of axonal growth and neurite arborisation to occur (Fig. 7). As GITR signalling only affects growth in the presence of NGF (O'Keeffe et al., 2008), this would only allow neurons receiving an adequate supply of NGF to achieve an adequate balance of NF-κB and Erk activation, thereby providing an optimal environment for neurite growth. In neurons that do not receive an adequate supply of NGF, this may result in a lack of autocrine GITRL-GITR signalling, which results in the inhibitory block on NF-κB being released, and a concurrent decrease in Erk activity leading to an inhibition in neurite growth (Fig. 7). This co-accessory role for GITR has been demonstrated in the immune system where CD3 stimulation in T-cells induces a robust proliferative response (Ronchetti et al., 2004), which is enhanced by their co-stimulation with GITRL (Ronchetti et al., 2004). However, activation of GITR in the absence of anti-CD3 does not induce any proliferative response (O'Keeffe et al., 2008). GITR-GITRL signalling in neurons may serve as an autocrine mechanism where active and permissive signals regulate axonal growth depending on the cellular environment. Neurons receiving an adequate supply of NGF can grow and branch normally as instructed by the active influence of growth promoting NGF-TrkA signalling and permissively by GITR-mediated suppression of NF-κB.
The molecular events and downstream changes in gene expression following NF-κB activation that inhibit growth of neural processes are unclear. As NF-κB activation can induce or repress the expression of many genes in different cellular contexts (Hoffmann et al., 2006), it remains unclear whether NF-κB mediated growth inhibition is brought about by repression of those genes involved in the promotion of growth or the induction of genes that can in turn negatively regulate growth. Some genes that are regulated by NF-κB such as the neural cell adhesion molecule, tenascin-C and β1 integrin may be potentially relevant in the control of neural process growth, (Mettouchi et al., 1997; Simpson and Morris, 2000; Wang et al., 2003). On the other hand, NF-κB-induced genes that can actively inhibit neurite growth have also been described (Nolan et al., 2011).
As GITR is expressed by other neurons in the developing nervous system, it will be important to determine how extensively it influences neurite growth during development. NF-κB has been shown to promote or inhibit neurite growth in different neuronal populations (Gutierrez et al., 2008). It is therefore conceivable that the GITR-mediated inverse modulation of NF-κB and Erk is only required in neurons in which NF-κB plays an inhibitory role in neurite growth. Indeed, GITR signalling does not affect neurite growth in sensory neurons of the nodose and trigeminal ganglia (data not shown) where NF-κB is known to promote (rather than inhibit) growth (Gutierrez et al., 2005; Gallagher et al., 2007; Gavaldà et al., 2009).
In summary, our results demonstrate that autocrine GITRL-GITR signalling regulates Erk and NF-κB activation in order to provide an optimal environment for NGF-promoted neurite growth. This suggests a mechanism whereby axonal growth in neonatal sympathetic neurons may be regulated by a delicate cellular balance between active and permissive growth promoting and growth inhibiting signals depending on the availability of NGF. Our results will help to explain why neonatal sympathetic neurons have a basal level of NF-κB activity and raise intriguing questions for future research regarding the importance that regulating NF-κB signalling has for the correct formation of the sympathetic nervous system.
Notes
Competing interests: The authors have no competing interests to declare.
The dominant negative IKKβ plasmid was kindly supplied by Dr. Ruaidhri Carmody of University College Cork. This work was supported by a Wellcome Trust program grant (Grant no. 085984) to A.M.D. and a Research Frontiers Program grant (10/RFP/NES2786) to G.W.O'K. from Science Foundation Ireland.
References
| Armstrong A.,Ryu Y. K.,Chieco D.,Kuruvilla R.. (Year: 2011). Frizzled3 is required for neurogenesis and target innervation during sympathetic nervous system development.J. Neurosci.31, 2371–238110.1523/JNEUROSCI.4243-10.201121325504 | |
| Bae E. M.,Kim W. J.,Suk K.,Kang Y. M.,Park J. E.,Kim W. Y.,Choi E. M.,Choi B. K.,Kwon B. S.,Lee W. H.. (Year: 2008). Reverse signaling initiated from GITRL induces NF-κB activation through ERK in the inflammatory activation of macrophages.Mol. Immunol.45, 523–53310.1016/j.molimm.2007.05.01317602748 | |
| Beinke S.,Robinson M. J.,Hugunin M.,Ley S. C.. (Year: 2004). Lipopolysaccharide activation of the TPL-2/MEK/extracellular signal-regulated kinase mitogen-activated protein kinase cascade is regulated by IκB kinase-induced proteolysis of NF-κB1 p105.Mol. Cell. Biol.24, 9658–966710.1128/MCB.24.21.9658-9667.200415485931 | |
| Bodmer D.,Levine-Wilkinson S.,Richmond A.,Hirsh S.,Kuruvilla R.. (Year: 2009). Wnt5a mediates nerve growth factor-dependent axonal branching and growth in developing sympathetic neurons.J. Neurosci.29, 7569–758110.1523/JNEUROSCI.1445-09.200919515925 | |
| Campenot R. B.. (Year: 1994). NGF and the local control of nerve terminal growth.J. Neurobiol.25, 599–61110.1002/neu.4802506038071664 | |
| Das S.,Cho J.,Lambertz I.,Kelliher M. A.,Eliopoulos A. G.,Du K.,Tsichlis P. N.. (Year: 2005). Tpl2/cot signals activate ERK, JNK, and NF-κB in a cell-type and stimulus-specific manner.J. Biol. Chem.280, 23748–2375710.1074/jbc.M41283720015833743 | |
| Edwards R. H.,Rutter W. J.,Hanahan D.. (Year: 1989). Directed expression of NGF to pancreatic β cells in transgenic mice leads to selective hyperinnervation of the islets.Cell58, 161–17010.1016/0092-8674(89)90412-12665941 | |
| Eliopoulos A. G.,Wang C. C.,Dumitru C. D.,Tsichlis P. N.. (Year: 2003). Tpl2 transduces CD40 and TNF signals that activate ERK and regulates IgE induction by CD40.EMBO J.22, 3855–386410.1093/emboj/cdg38612881420 | |
| Esparza E. M.,Arch R. H.. (Year: 2004). TRAF4 functions as an intermediate of GITR-induced NF-κB activation.Cell. Mol. Life Sci.61, 3087–309210.1007/s00018-004-4417-015583869 | |
| Esparza E. M.,Lindsten T.,Stockhausen J. M.,Arch R. H.. (Year: 2006). Tumor necrosis factor receptor (TNFR)-associated factor 5 is a critical intermediate of costimulatory signaling pathways triggered by glucocorticoid-induced TNFR in T cells.J. Biol. Chem.281, 8559–856410.1074/jbc.M51291520016452475 | |
| Gallagher D.,Gutierrez H.,Gavalda N.,O'Keeffe G.,Hay R.,Davies A. M.. (Year: 2007). Nuclear factor-κB activation via tyrosine phosphorylation of inhibitor κB-α is crucial for ciliary neurotrophic factor-promoted neurite growth from developing neurons.J. Neurosci.27, 9664–966910.1523/JNEUROSCI.0608-07.200717804627 | |
| Gavaldà N.,Gutierrez H.,Davies A. M.. (Year: 2009). Developmental switch in NF-κB signalling required for neurite growth.Development136, 3405–341210.1242/dev.03529519762427 | |
| Glebova N. O.,Ginty D. D.. (Year: 2004). Heterogeneous requirement of NGF for sympathetic target innervation in vivo.J. Neurosci.24, 743–75110.1523/JNEUROSCI.4523-03.200414736860 | |
| Glebova N. O.,Ginty D. D.. (Year: 2005). Growth and survival signals controlling sympathetic nervous system development.Annu. Rev. Neurosci.28, 191–22210.1146/annurev.neuro.28.061604.13565916022594 | |
| Grohmann U.,Volpi C.,Fallarino F.,Bozza S.,Bianchi R.,Vacca C.,Orabona C.,Belladonna M. L.,Ayroldi E.,Nocentini G.. et al. (Year: 2007). Reverse signaling through GITR ligand enables dexamethasone to activate IDO in allergy.Nat. Med.13, 579–58610.1038/nm156317417651 | |
| Gutierrez H.,Davies A. M.. (Year: 2007). A fast and accurate procedure for deriving the Sholl profile in quantitative studies of neuronal morphology.J. Neurosci. Methods163, 24–3010.1016/j.jneumeth.2007.02.00217367866 | |
| Gutierrez H.,Davies A. M.. (Year: 2011). Regulation of neural process growth, elaboration and structural plasticity by NF-κB.Trends Neurosci.34, 316–32510.1016/j.tins.2011.03.00121459462 | |
| Gutierrez H.,Hale V. A.,Dolcet X.,Davies A.. (Year: 2005). NF-κB signalling regulates the growth of neural processes in the developing PNS and CNS.Development132, 1713–172610.1242/dev.0170215743881 | |
| Gutierrez H.,O'Keeffe G. W.,Gavaldà N.,Gallagher D.,Davies A. M.. (Year: 2008). Nuclear factor κB signaling either stimulates or inhibits neurite growth depending on the phosphorylation status of p65/RelA.J. Neurosci.28, 8246–825610.1523/JNEUROSCI.1941-08.200818701687 | |
| Hauer J.,Püschner S.,Ramakrishnan P.,Simon U.,Bongers M.,Federle C.,Engelmann H.. (Year: 2005). TNF receptor (TNFR)-associated factor (TRAF) 3 serves as an inhibitor of TRAF2/5-mediated activation of the noncanonical NF-κB pathway by TRAF-binding TNFRs.Proc. Natl. Acad. Sci. USA102, 2874–287910.1073/pnas.050018710215708970 | |
| Hoffmann A.,Natoli G.,Ghosh G.. (Year: 2006). Transcriptional regulation via the NF-κB signaling module.Oncogene25, 6706–671610.1038/sj.onc.120993317072323 | |
| Honma Y.,Araki T.,Gianino S.,Bruce A.,Heuckeroth R.,Johnson E.,Milbrandt J.. (Year: 2002). Artemin is a vascular-derived neurotropic factor for developing sympathetic neurons.Neuron35, 267–28210.1016/S0896-6273(02)00774-212160745 | |
| Krausz L. T.,Bianchini R.,Ronchetti S.,Fettucciari K.,Nocentini G.,Riccardi C.. (Year: 2007). GITR-GITRL system, a novel player in shock and inflammation.ScientificWorldJournal7, 533–56610.1100/tsw.2007.10617525820 | |
| Levi-Montalcini R.. (Year: 1987). The nerve growth factor 35 years later.Science237, 1154–116210.1126/science.33069163306916 | |
| Markus A.,Patel T. D.,Snider W. D.. (Year: 2002). Neurotrophic factors and axonal growth.Curr. Opin. Neurobiol.12, 523–53110.1016/S0959-4388(02)00372-012367631 | |
| Mettouchi A.,Cabon F.,Montreau N.,Dejong V.,Vernier P.,Gherzi R.,Mercier G.,Binétruy B.. (Year: 1997). The c-Jun-induced transformation process involves complex regulation of tenascin-C expression.Mol. Cell. Biol.17, 3202–32099154819 | |
| Nolan A. M.,Nolan Y. M.,O'Keeffe G. W.. (Year: 2011). IL-1β inhibits axonal growth of developing sympathetic neurons.Mol. Cell. Neurosci.48, 142–15010.1016/j.mcn.2011.07.00321791245 | |
| O'Keeffe G. W.,Gutierrez H.,Pandolfi P. P.,Riccardi C.,Davies A. M.. (Year: 2008). NGF-promoted axon growth and target innervation requires GITRL-GITR signaling.Nat. Neurosci.11, 135–14210.1038/nn203418176559 | |
| Roff M.,Thompson J.,Rodriguez M. S.,Jacque J.-M.,Baleux F.,Arenzana-Seisdedos F.,Hay R. T.. (Year: 1996). Role of IκBα ubiquitination in signal-induced activation of NFκB in vivo.J. Biol. Chem.271, 7844–785010.1074/jbc.271.13.78448631829 | |
| Ronchetti S.,Zollo O.,Bruscoli S.,Agostini M.,Bianchini R.,Nocentini G.,Ayroldi E.,Riccardi C.. (Year: 2004). GITR, a member of the TNF receptor superfamily, is costimulatory to mouse T lymphocyte subpopulations.Eur. J. Immunol.34, 613–62210.1002/eji.20032480414991590 | |
| Sholl D. A.. (Year: 1953). Dendritic organization in the neurons of the visual and motor cortices of the cat.J. Anat.87, 387–40613117757 | |
| Simpson C. S.,Morris B. J.. (Year: 2000). Regulation of neuronal cell adhesion molecule expression by NF-κB.J. Biol. Chem.275, 16879–1688410.1074/jbc.275.22.1687910828070 | |
| Thompson J.,Dolcet X.,Hilton M.,Tolcos M.,Davies A. M.. (Year: 2004). HGF promotes survival and growth of maturing sympathetic neurons by PI-3 kinase- and MAP kinase-dependent mechanisms.Mol. Cell. Neurosci.27, 441–45210.1016/j.mcn.2004.07.00715555922 | |
| Vizard T. N.,O'Keeffe G. W.,Gutierrez H.,Kos C. H.,Riccardi D.,Davies A. M.. (Year: 2008). Regulation of axonal and dendritic growth by the extracellular calcium-sensing receptor.Nat. Neurosci.11, 285–29110.1038/nn204418223649 | |
| Wang J. H.,Manning B. J.,Wu Q. D.,Blankson S.,Bouchier-Hayes D.,Redmond H. P.. (Year: 2003). Endotoxin/lipopolysaccharide activates NF-κB and enhances tumor cell adhesion and invasion through a β1 integrin-dependent mechanism.J. Immunol.170, 795–80412517943 | |
| Waterfield M. R.,Zhang M.,Norman L. P.,Sun S. C.. (Year: 2003). NF-κB1/p105 regulates lipopolysaccharide-stimulated MAP kinase signaling by governing the stability and function of the Tpl2 kinase.Mol. Cell11, 685–69410.1016/S1097-2765(03)00070-412667451 | |
| Zhou Z.,Tone Y.,Song X.,Furuuchi K.,Lear J. D.,Waldmann H.,Tone M.,Greene M. I.,Murali R.. (Year: 2008). Structural basis for ligand-mediated mouse GITR activation.Proc. Natl. Acad. Sci. USA105, 641–64510.1073/pnas.071120610518178614 |
Figures
Article Categories:
Keywords: Key words GITR, NF-κB, NGF, Growth, Neurite, Neuron. |
|
Previous Document: The labial gene is required to terminate proliferation of identified neuroblasts in postembryonic de...
Next Document: Membrane microdomain-associated uroplakin IIIa contributes to Src-dependent mechanisms of anti-apopt...







