Document Detail


Diverse Families of Antimicrobial Peptides Isolated from Skin Secretions of Three Species of East Asian Frogs, Babina daunchina, Babina adenopleura, and Rana omeimontis (Ranidae).
MedLine Citation:
PMID:  25001915     Owner:  NLM     Status:  In-Data-Review    
Abstract/OtherAbstract:
Twenty-two novel cDNAs encoding 22 peptide precursors for 19 mature peptides including antimicrobial peptides (AMPs) were identified from East Asian frog species Babina daunchina, Babina adenopleura, and Rana omeimontis skin-derived cDNA libraries. Two atypical members of the brevinin-1 family AMPs, named brevinin-1AN1 (FLTGVLKLASKIPSVLCAVLKTC) and brevinin-1DN1(FLKGVINLASKIPSMLCAVLKTC), were purified from the skin secretions of B. adenopleura and B. daunchina, respectively. A member of the ranatuerin-2 family AMP named ranatuerin-2DN1 (GLFDSITQGLKDTAVKLLDKIKCKLSACPPA) was also purified from the skin secretion of B. daunchina. One AMP named japonicin-2OM1 (FIVPSIFLLKKAFCIALKKNC) was purified from the skin secretion of R. omeimontis. The antimicrobial tests showed that brevinin-1DN1, brevinin-1DN2, brevinin-1AN1, and japonicin-2OM1 possess higher antimicrobial activity against Gram-positive bacteria than Gram-negative bacteria.
Authors:
Yuhong Hu; Shiqi Xu; Yonghong Hu; Chao Guo; Hao Meng; Jing Li; Jingze Liu; Hui Wang
Related Documents :
20564025 - Cyclotides, a promising molecular scaffold for peptide-based therapeutics.
12415245 - Designing peptide receptor agonists and antagonists.
22209865 - N-succinimidyl 4-[(18)f]-fluoromethylbenzoate-labeled dimeric rgd peptide for imaging t...
24449375 - Fractionation of protein hydrolysates of fish and chicken using membrane ultrafiltratio...
23427155 - Structure and dynamics of adeno-associated virus serotype 1 vp1-unique n-terminal domai...
19245795 - New insights into the molecular interaction of the c-terminal sequence of cxcl4 with fi...
Publication Detail:
Type:  Journal Article    
Journal Detail:
Title:  Zoological science     Volume:  31     ISSN:  0289-0003     ISO Abbreviation:  Zool. Sci.     Publication Date:  2014 Jul 
Date Detail:
Created Date:  2014-07-08     Completed Date:  -     Revised Date:  -    
Medline Journal Info:
Nlm Unique ID:  8702287     Medline TA:  Zoolog Sci     Country:  Japan    
Other Details:
Languages:  eng     Pagination:  438-44     Citation Subset:  IM    
Export Citation:
APA/MLA Format     Download EndNote     Download BibTex
MeSH Terms
Descriptor/Qualifier:

From MEDLINE®/PubMed®, a database of the U.S. National Library of Medicine


Previous Document:  Nest-Site Selection Analysis of Hooded Crane (Grus monacha) in Northeastern China Based on a Multiva...
Next Document:  External traces of segmentation of the labium in the corixoidea (hemiptera: heteroptera: nepomorpha)...